Sale!

exploreourselectiontofindproductsfromflirtypheasantswallpapergrahambrownatlowcosts0.jpg

exploreourselectiontofindproductsfromflirtypheasantswallpapergrahambrownatlowcosts1.jpg

Flirty Pheasants Wallpaper Graham & Brown

$ 42,50

SKU: mode_7416940593197 Category: Decor/Wall Decor/All Wallpaper/Permanent Wallpaper Tags: Brand: Graham & Brown, Collection: Flirty Pheasants, Collection: Joules, Color: Pink, Color: White, Decor, Feature: Quick Ship, GTK: Sustainable Brand, Indoor, Material: Paper, Pattern: Animal, Permanent, Primary: Wallpaper, Wallpaper

Description
shopping

Swatches are available for this wallpaper here.

Make a statement and add a fresh pop of color to your home with this flirty pheasant wallpaper design. Bright pink pheasants sit perfectly upon a neutral background. Whether on all 4 walls or as a single feature point, this wallpaper is sure to bring country charm to your home.

Features

Part of Joules Collection
A special type of removable wallpaper that is designed to stick on the wall and peel off easily
Quick & easy ‘Paste The Wall’ application (you apply the paste directly to the wall, no decorating table or pre-cutting required)
Spongeable (adhesive may be wiped gently from the face of the wallcovering with a damp cloth at the time of hanging while the adhesive is still damp)
Removal Type: Strippable. Remove wallpaper dry in full strips leaving minimal paste residue and without damaging the wall
Non-woven wallpaper, won’t shrink or expand over time
Offers a smooth, untextured finish
Offset match with a 20.87 inch pattern repeat
Strippable
Application: Paste the Wall
Available in Truly Pink color

Prompt Shipping and Professional Packing

Due to our longstanding partnership with UPS FedEx DHL, and other leading global carriers, we can offer a variety shipping options. Our warehouse personnel are extremely skilled and will package your goods in accordance to our precise and precise specifications. Your items will undergo an extensive inspection and will be adequately secured before being delivered. We ship to thousands of customers daily across various countries. This shows our commitment to be the largest online retailer on earth. The warehouses and centers of distribution are in Europe and the USA.

Note: Orders containing more than one item will be assigned a distinct processing time depending on the specific product.

Prior to shipment Our team will conduct an exhaustive inspection of the products you have ordered. The majority of orders are delivered within 48 hours. The expected delivery time will be between 3 and 7 days.

Returns

Due to multiple entities such as the factory and the warehouse, we're unable to fully manage stock. This means that the actual stock could fluctuate at any moment. It is possible that the stocks could be depleted after the order has been made.

The policy is for 30 days. We will not return or exchange your purchase when it's been 30 days since the purchase.

The item should not be used and in its original condition. The item must be in the original packaging.

Flirty Pheasants Wallpaper Graham & Brown

Related products

Login